Skip to product information
1 of 1

Gene Bio Systems

Recombinant Accessory gene regulator protein B(agrB)

Recombinant Accessory gene regulator protein B(agrB)

SKU:CSB-CF313814FLL

Regular price $1,795.00 USD
Regular price Sale price $1,795.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Staphylococcus epidermidis

Uniprot NO.:P0C0N4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKIIDKKIEQFAQYLQRKNNLDHIQFLKIRLGMQVLAINIEKSIVVYGLAIIFHTFFYTL LTHLSYFLIRRHAHGTHANSSLLCHIQNIIFFIIFPYLIIKLDINYFVLLSMALVGLIIT ILYAPAATKKQPIPRRLVKRKKILSIFLYCTIVVISLVTKEPVNKLILFGVILESLTLLP IFFPKEDINHGKHF

Protein Names:Recommended name: Accessory gene regulator protein B EC= 3.4.-.-

Gene Names:Name:agrB

Expression Region:1-194

Sequence Info:full length protein

View full details