Gene Bio Systems
Recombinant Acaryochloris marina ATP synthase subunit a 1(atpB1)
Recombinant Acaryochloris marina ATP synthase subunit a 1(atpB1)
SKU:CSB-CF532002AVV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Acaryochloris marina (strain MBIC 11017)
Uniprot NO.:B0BZK7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPLASLEVGQHLYWQIGGLKVHGQVLITSWIVIGILVIVSVLATRKVERIPSGLQNFMEY ALEFVRDLTKNQIGEKEYRPWVPFIGTLFLFIFVSNWSGALFPWKLISLPEGELAAPTND INTTVALALCTSFVYFYAGFRKKGLGYFRKYIEPTPVLLPIAILEDFTKPLSLSFRLFGN ILADELVVAVLVLLVPLIVPLPVMLLGLFTSGIQALVFATLAGAYIHESLEGHGEEEEAH
Protein Names:Recommended name: ATP synthase subunit a 1 Alternative name(s): ATP synthase F0 sector subunit a 1 F-ATPase subunit 6 1
Gene Names:Name:atpB1 Synonyms:atpI1 Ordered Locus Names:AM1_0891
Expression Region:1-240
Sequence Info:full length protein
