Recombinant Acanthamoeba polyphaga mimivirus  Uncharacterized protein L20(MIMI_L20)

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L20(MIMI_L20)

CSB-CF725967ADAZ
Regular price
$1,100.00 USD
Sale price
$1,100.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Acanthamoeba polyphaga mimivirus (APMV)

Uniprot NO.:Q5UP90

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFKNMMENMNNKKIAMIIIIFYVITSMVQGNYHFAILGAYFIIKNIFEYKFNKGIELPSI NYTIIGTIIGQYTVLIIMIFCRDNFSDNPYIEQILTTNLSIVGYAFGSFWYRCITTQN

Protein Names:Recommended name: Uncharacterized protein L20

Gene Names:Ordered Locus Names:MIMI_L20

Expression Region:1-118

Sequence Info:full length protein

Your list is ready to share