Skip to product information
1 of 1

Gene Bio Systems

Recombinant Absidia glauca Actin-1(ACT1)

Recombinant Absidia glauca Actin-1(ACT1)

SKU:CSB-EP320814AAD

Regular price $963.00 USD
Regular price Sale price $963.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: P10982

Gene Names: ACT1

Organism: Absidia glauca (Pin mould)

AA Sequence: MSMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMTQIMFETFNAPAFYVSIQA

Expression Region: 1-140aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-tagged

MW: 21.2 kDa

Alternative Name(s):

Relevance: Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.

Reference:

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details