Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Cytochrome c oxidase subunit 1(MT-CO1),partial

Recombinant Human Cytochrome c oxidase subunit 1(MT-CO1),partial

SKU:CSB-EP015072HU

Regular price $890.00 USD
Regular price Sale price $890.00 USD
Sale Sold out
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:P00395

Gene Names:MT-CO1

Organism:Homo sapiens (Human)

AA Sequence:EAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS

Expression Region:474-513aa

Sequence Info:Partial

Source:E.coli

Tag Info:N-terminal 6xHis-GST-tagged

MW:36.3 kDa

Alternative Name(s):Cytochrome c oxidase polypeptide I (COI) (COXI) (MTCO1)

Relevance:Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Reference:"Lineage-specific selection in human mtDNA: lack of polymorphisms in a segment of MTND5 gene in haplogroup J." Moilanen J.S., Finnila S., Majamaa K. Mol. Biol. Evol. 20:2132-2142(2003)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:13-23 business days

View full details