View larger

Recombinant Pinus thunbergii Chlorophyll a-b binding protein type I, chloroplastic

CSB-CF319149EVZ

Recombinant Pinus thunbergii Chlorophyll a-b binding protein type I, chloroplastic

See below for Detailed Description

More details

CAD$1,576.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pinus thunbergii (Japanese black pine) (Pinus thunbergiana)

Uniprot NO.:P10049

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RRTVRSAPESIWYGPDRPKYLGPFSEGTPSYLTGEFPGDYGWDTAAVSADPETFAKNREL EVIHCRWAMLGALGCVFPELLAKNGLKFGEAVWFKAGAQIFSEGGLDYAGNPNLIHAQSI LAIWACQVVLMGLIEGYRVGGGTLGEGLDPLLPGGAFDPLGLADDPEACAELKVKEIKNG RLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANNAWAYATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein type I, chloroplastic Short name= CAB Short name= LHCP

Gene Names:

Expression Region:39-266

Sequence Info:full length protein

30 other products in the same category: