View larger

Recombinant Mouse Derlin-3(Derl3)

CSB-CF866711MO

Recombinant Mouse Derlin-3(Derl3)

See below for Detailed Description

More details

CAD$1,576.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9D8K3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGQRLAAGFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITT FLFFGPLGFGFFFNMLFVFRYCRMLEEGSFRGRKADFVFMFLFGGVLMTLLGFLGSLFFL GQALMAMLVYVWSRRSPHVRVNFFGLLNFQAPFLPWALMGFSLLLGNSVVTDLLGILVGH IYYFLEDVFPNQPGGKRLLLTPSVLKLLLDDPQEDPDYLPLPEEQPEL

Protein Names:Recommended name: Derlin-3 Alternative name(s): Degradation in endoplasmic reticulum protein 3 Der1-like protein 3 Protein IZP6

Gene Names:Name:Derl3 Synonyms:Der3, Izp6

Expression Region:1-228

Sequence Info:full length protein

30 other products in the same category: