View larger

Recombinant Chlorocebus aethiops CD9 antigen(CD9)

CSB-CF004969DSU

Recombinant Chlorocebus aethiops CD9 antigen(CD9)

See below for Detailed Description

More details

CAD$1,575.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)

Uniprot NO.:P30409

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:PVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVY ILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEV QEFYKDTYNKLKTKDEPQRETLKAIHYALDCCGLAGGVEQFISDICPKKDVLETFTIKSC PDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

Protein Names:Recommended name: CD9 antigen Alternative name(s): 27 kDa diphtheria toxin receptor-associated protein Short name= DRAP27 CD_antigen= CD9

Gene Names:Name:CD9

Expression Region:2-228

Sequence Info:full length protein

30 other products in the same category: