View larger

Recombinant Schizosaccharomyces pombe Protein svp26(svp26)

CSB-CF635939SXV

Recombinant Schizosaccharomyces pombe Protein svp26(svp26)

See below for Detailed Description

More details

CAD$1,575.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q1MTR8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIVLNALSYLGIVLGFIGMTVSIASALYYISEFVEEHSRLAKAFLCRLVYFIMAVMVFLV IFDGFPFWLSAFSIFSHYIYKINFDTFPFFSFKRMRFLLACFLIVANHILWVRFFQVHEF PIKPRGLTYDFVGQRLLTSRASFSQVASFMGVCVWSVPIGIFVSFTAADNTLPTITTPSS SSPDAYSSGSSRRTSNVLRQAYKKLGIFVERSLTSLGLSDRSSERYV

Protein Names:Recommended name: Protein svp26

Gene Names:Name:svp26 ORF Names:SPCC1795.10c

Expression Region:1-227

Sequence Info:full length protein

30 other products in the same category: