View larger

Recombinant Human CKLF-like MARVEL transmembrane domain-containing protein 5(CMTM5)

CSB-CF842660HU

Recombinant Human CKLF-like MARVEL transmembrane domain-containing protein 5(CMTM5)

See below for Detailed Description

More details

CAD$1,570.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q96DZ9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYM AAALLEFFITLAFLFLYATQYYQRFDRINWPCLLQGHGQSGGPHPLDLLSHSAKVQPQPW PGLTPPGWHTPAAVPWVPAPAPGFWSWLLWFICFHSLGSSDFLRCVSAIIIFLVVSFAAV TSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ

Protein Names:Recommended name: CKLF-like MARVEL transmembrane domain-containing protein 5 Alternative name(s): Chemokine-like factor superfamily member 5

Gene Names:Name:CMTM5 Synonyms:CKLFSF5

Expression Region:1-223

Sequence Info:full length protein

30 other products in the same category: