View larger

Recombinant Membrane protein insertase YidC(yidC)

CSB-CF806152CMN

Recombinant Membrane protein insertase YidC(yidC)

See below for Detailed Description

More details

CAD$1,567.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Clostridium tetani

Uniprot NO.:Q899S4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSHLNNALVEFFVIIHKFISSIITNPNYSYGVAIIFVTLIIKLILLPLNIKSMRSTIRIN EIQPEIQKIQKKYKNDPQRLQQEQMKLYKEYNINPFGSCLPLLLQWPILIALYYVFNNIQ GISGVSFLWVKDLASPDIVLAVLAGATQYYSGLLMNPKGDNTQAKTASNMNLSMSIMMIF ISSRLKAALVIYWVTGNLIQMGQTILTKKLEQKHSANKDA

Protein Names:Recommended name: Membrane protein insertase YidC Alternative name(s): Foldase YidC Membrane integrase YidC Membrane protein YidC

Gene Names:Name:yidC Ordered Locus Names:CTC_00096

Expression Region:1-220

Sequence Info:full length protein

30 other products in the same category: