View larger

Recombinant Escherichia coli D-methionine transport system permease protein metI(metI)

CSB-CF339179ENV

Recombinant Escherichia coli D-methionine transport system permease protein metI(metI)

See below for Detailed Description

More details

CAD$1,564.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P31547

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSEPMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIV NIFRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLI EASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYG YIGYNATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK

Protein Names:Recommended name: D-methionine transport system permease protein metI

Gene Names:Name:metI Synonyms:yaeE Ordered Locus Names:b0198, JW0194

Expression Region:1-217

Sequence Info:full length protein

30 other products in the same category: