View larger

Recombinant Danio rerio Claudin-7-B(cldn7b)

CSB-CF897044DIL

Recombinant Danio rerio Claudin-7-B(cldn7b)

See below for Detailed Description

More details

CAD$1,562.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q9YH92

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAHKGLQLLGFTLSLLGLIGLIIGTIMPQWKMSAYVGDNIITAIAMYQGLWMSCAYQSTG QQQCKVYDSVLQLDSALQATRALMVVAILLTVAGLGVASMGMKCTNCGGDDKVKKSRIAM TGGIILSVGALCSIVACGWFTSQIIRDFYNPFTPVNTKYEFGAAIFIAWAGAFLDIMGGG MLASSCSKGQSSPNYPKSSRPVKSSRPPSSSKEYV

Protein Names:Recommended name: Claudin-7-B Alternative name(s): Claudin-like protein ZF4A22

Gene Names:Name:cldn7b Synonyms:cldn7

Expression Region:1-215

Sequence Info:full length protein

30 other products in the same category: