Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mink astrovirus 1 (MAstV-1)
Uniprot NO.:Q80KJ8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AKGKTKHKRRIMAAARSGGKRKPGKVWTEEEYKKLLEEGFTRDQLREMAEAAREADDDFD DYEEEKNEVDYPVWSDHDSDEEIDRDWFGQNLPTWSSAWSDFEPELDPDVTKTLPCHLED KFSLKHYIITEADLKHFGQEMKEYMDHLDAVIKTHTEKGKWCPNTNTEEILKDLNAMWFK LNHTMWKNGVAPFMQRKKQKPKNGKRAPKGAQ
Protein Names:Recommended name: Non-structural polyprotein 1A Cleaved into the following 4 chains: 1. Protein p19 2. Transmembrane protein 1A 3. Serine protease p27 Short name= 4. p27 EC= 5. 3.4.21.- 6. Protein p20'
Gene Names:Name:ORF1
Expression Region:663-874
Sequence Info:full length protein