View larger

Recombinant Aeromonas hydrophila subsp. hydrophila Na(+)-translocating NADH-quinone reductase subunit D

CSB-CF369004AUH

Recombinant Aeromonas hydrophila subsp. hydrophila Na(+)-translocating NADH-quinone reductase subunit D

See below for Detailed Description

More details

CAD$1,557.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240)

Uniprot NO.:A0KHC9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADKSEMKKLLLTPVLGNNPIALQVLGVCSALAVTSQMKTAFVMTLAVTAVTAFSNLFIS LIRNQIPNSVRIIAQMAVIASLVIVVDQVLKAYAYDISKQLSVFVGLIITNCIVMGRAEA YAMKSAPLPSFLDGIGNGLGYGAVLLTVATVREILGSGTWFGIELLPLVNNGGWYVPNGL LLLPPSAFFIIGLIIWGVRTKDPKQVEAKD

Protein Names:Recommended name: Na(+)-translocating NADH-quinone reductase subunit D Short name= Na(+)-NQR subunit D Short name= Na(+)-translocating NQR subunit D EC= 1.6.5.- Alternative name(s): NQR complex subunit D NQR-1 subunit D

Gene Names:Name:nqrD Ordered Locus Names:AHA_1139

Expression Region:1-210

Sequence Info:full length protein

30 other products in the same category: