View larger

Recombinant Dictyostelium discoideum Protein TEX261 homolog(DDB_G0291374)

CSB-CF703681DKK

Recombinant Dictyostelium discoideum Protein TEX261 homolog(DDB_G0291374)

See below for Detailed Description

More details

CAD$1,553.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q54ER8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFLSLLILLSYALGFVFCVVCLACGLYYFSELVEEHATVAKRWIKYTMWFVMGIIFLLGI FEDLDFTSLLFSFIGHCCYYTLLTEFPFVTLTGYKFILSVLSFIISHISWFIYFRNTENW YPFGEIIAIFTFCVWLIPLIFFISLAANDNSLPMANSYSSHSNSNIIGVDSEFTKKKSRI SVLKSMFAWAKEKTSDITGQKSMKHYY

Protein Names:Recommended name: Protein TEX261 homolog

Gene Names:ORF Names:DDB_G0291374

Expression Region:1-207

Sequence Info:full length protein

30 other products in the same category: