View larger

Recombinant Escherichia coli O45:K1 Glycerol-3-phosphate acyltransferase(plsY)

CSB-CF483460EOK

Recombinant Escherichia coli O45:K1 Glycerol-3-phosphate acyltransferase(plsY)

See below for Detailed Description

More details

CAD$1,551.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli O45:K1 (strain S88 / ExPEC)

Uniprot NO.:B7MAZ5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSAIAPGMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGATNVLRIGGKGAAVAVLI FDVLKGMLPVWGAYELGVSPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN IQRLWRRQETKIWTKFKRKREKDPE

Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): G3P acyltransferase Short name= GPAT EC= 2.3.1.15 EC= 2.3.1.n5 Lysophosphatidic acid synthase Short name= LPA synthase

Gene Names:Name:plsY Synonyms:ygiH Ordered Locus Names:ECS88_3457

Expression Region:1-205

Sequence Info:full length protein

30 other products in the same category: