View larger

Recombinant Arabidopsis thaliana Casparian strip membrane protein 4(CASP4)

CSB-CF866914DOA

Recombinant Arabidopsis thaliana Casparian strip membrane protein 4(CASP4)

See below for Detailed Description

More details

CAD$1,548.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9FFZ7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKSDSIAVDVPAESSSVIKGKAPLLGLARDHTGSGGYKRGLSIFDFLLRLAAIVAALAAA ATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVVAIAIVAGYLVLSLPFSVVTIVRPLAV APRLLLLVLDTAALALDTAAASAAAAIVYLAHNGNTNTNWLPICQQFGDFCQKTSGAVVS AFASVTFLAILVVISGVSLKRP

Protein Names:Recommended name: Casparian strip membrane protein 4

Gene Names:Name:CASP4 Ordered Locus Names:At5g06200 ORF Names:MBL20.8

Expression Region:1-202

Sequence Info:full length protein

30 other products in the same category: