View larger

Recombinant Schizosaccharomyces pombe Protein transport protein sft2(sft2)

CSB-CF889214SXV

Recombinant Schizosaccharomyces pombe Protein transport protein sft2(sft2)

See below for Detailed Description

More details

CAD$1,547.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q9P6K1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEGSFQSRLQSIIQRTGETTAESTNSWYNRLRTSMPWSNDYTEIPTNASGGNSYFQSSEF SLSRWERYMLFGICLLGSLACYAIACFMFPVLVLKPRKFVLLWTMGSLLAVLGFAIVQGF VAHFRQLTTMERLPITLSYFVTLLATIIATIKIKSTILSIVFGVLHILSFVAYLIAFFPF GTRTVSLGTRMASRSLSNWLP

Protein Names:Recommended name: Protein transport protein sft2

Gene Names:Name:sft2 ORF Names:SPAC1527.02

Expression Region:1-201

Sequence Info:full length protein

30 other products in the same category: