Recombinant Neisseria meningitidis serogroup A - serotype 4A  Glycerol-3-phosphate acyltransferase(plsY)

Recombinant Neisseria meningitidis serogroup A - serotype 4A Glycerol-3-phosphate acyltransferase(plsY)

CSB-CF888390NGF
Regular price
$1,546.00 CAD
Sale price
$1,546.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

Uniprot NO.:Q9JUL4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFNIPAVAVSYLIGSLSFAVIVSKYYGMDDPRTYGSGNPGATNVLRSGKKKAAALTLLGD AAKGLVAVLLARVLQEPLGLSDSAIAAVALAALVGHMWPVFFGFKGGKGVATALGVLLAL SPTTALVCALIWLVMAFGFKVSSLAALTATIAAPLAALFFMPHTSWIFATLAIAILVLLR HKSNILNLIKGKESKIGEKR

Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati

Gene Names:Name:plsY Ordered Locus Names:NMA1261

Expression Region:1-200

Sequence Info:full length protein

Your list is ready to share