View larger

Recombinant Pseudomonas syringae pv. phaseolicola Probable intracellular septation protein A(PSPPH_3544)

CSB-CF675323PAAT

Recombinant Pseudomonas syringae pv. phaseolicola Probable intracellular septation protein A(PSPPH_3544)

See below for Detailed Description

More details

CAD$1,544.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6)

Uniprot NO.:Q48FZ3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQFIDFIPLLLFFIVYKTEPRAVDILGNTYMVGGIFSATAMLIISSVVVYGILYLKQRK LEKSQWLTLVACLVFGSLTLAFHSETFLKWKAPVVNWLFAVAFAGSHFIGDRPIIQRIMG HALTLPAAIWTRLNIAWIVFFLFCGAANLYVAFTYQEFWVDFKVFGSLGMTLIFLVGQGI YLSRHLHDTAPNTTKSED

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:PSPPH_3544

Expression Region:1-198

Sequence Info:full length protein

30 other products in the same category: