View larger

Recombinant Pseudomonas entomophila Probable intracellular septation protein A(PSEEN3905)

CSB-CF627100PAAK

Recombinant Pseudomonas entomophila Probable intracellular septation protein A(PSEEN3905)

See below for Detailed Description

More details

CAD$1,544.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pseudomonas entomophila (strain L48)

Uniprot NO.:Q1I6X0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQFIDFIPLLLFFIVYKLDPRPVEFAGHGFEFGGIYSATAMLIVSSVVVYGALFLRHGK LEKGQLLTLVACLVFGGLTLAFHSETFLKWKAPVVNWLFALAFAGSHFIGDRVLIKRIMG HALTLPETVWNRLNVAWIGFFLVCGAANLFVAFTFQDFWVDFKVFGSLGMTVIFLVAQGV YLSRHLHDADPSTSKPKD

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:PSEEN3905

Expression Region:1-198

Sequence Info:full length protein

30 other products in the same category: