View larger

Recombinant Arabidopsis thaliana CASP-like protein At4g20390(At4g20390)

CSB-CF874528DOA

Recombinant Arabidopsis thaliana CASP-like protein At4g20390(At4g20390)

See below for Detailed Description

More details

CAD$1,543.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9SUP0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAREKIVVAGGTTKSWKLLLGLRIFAFMATLAAAIVMSLNKETKTLVVATIGTVPIKATL TAKFQHTPAFVFFVIANVMVSFHNLLMIVVQIFSRKLEYKGLRLLSIAILDMLNATLVSA AANAAVFVAELGKNGNKHAKWNKVCDRFTTYCDHGAGAIIAAFAGVILMLLVSAVSISRL LINSKNFSTTATTTSVV

Protein Names:Recommended name: CASP-like protein At4g20390

Gene Names:Ordered Locus Names:At4g20390 ORF Names:F9F13.40

Expression Region:1-197

Sequence Info:full length protein

30 other products in the same category: