View larger

Recombinant Bovine Mpv17-like protein(MPV17L)

CSB-CF646534BO

Recombinant Bovine Mpv17-like protein(MPV17L)

See below for Detailed Description

More details

CAD$1,542.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q2KIK2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVSWWQALTRAAGRYPWPANVLLYAGFFSGGDALQQVLRGGPADWQHTRHVATVAVAFHA NLNYVWLNLLERALPGRAPRTILAKVLCDQALGGPVYVSTFYAGMSILQGKDDIFLDMRQ KFWNTYKSGLMYWPFVQLINFSLIPIRWRTAYTGLCGFLWATFLCFSQQEGDGTFKSAFT FRRIKVTNEVEKPSEK

Protein Names:Recommended name: Mpv17-like protein Alternative name(s): M-LP homolog Short name= M-LPH

Gene Names:Name:MPV17L

Expression Region:1-196

Sequence Info:full length protein

30 other products in the same category: