View larger

Recombinant Inner membrane protein ydjM(ydjM)

CSB-CF353714SZB

Recombinant Inner membrane protein ydjM(ydjM)

See below for Detailed Description

More details

CAD$1,542.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Shigella flexneri

Uniprot NO.:P64482

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTAEGHLLFSIACAVFAKNAELTPVLAQGDWWHIVPSAILTCLLPDIDHPKSFLGQRLKW ISKPIARAFGHRGFTHSLLAVFALLATFYLKVPEGWFIPADALQGMVLGYLSHILADMLT PAGVPLLWPCRWRFRLPILVPQKGNQLERFICMALFVWSVWMPHSLPENSAVRWSSQMIN TLQIQFHRLIKHQVEY

Protein Names:Recommended name: Inner membrane protein ydjM

Gene Names:Name:ydjM Ordered Locus Names:SF1502, S1619

Expression Region:1-196

Sequence Info:full length protein

30 other products in the same category: