View larger

Recombinant Arabidopsis thaliana CASP-like protein At4g15610(At4g15610)

CSB-CF887726DOA

Recombinant Arabidopsis thaliana CASP-like protein At4g15610(At4g15610)

See below for Detailed Description

More details

CAD$1,539.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9FE29

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGYETKSTLDTERSTAPGTGTTTKSCSMTQVVLRFVLFAATLTSIVVMVTSKQTKNIFLP GTPIRIPAAEFTNSPALIYFVVALSVACFYSIVSTFVTVSAFKKHSCSAVLLLNLAIMDA VMVGIVASATGAGGGVAYLGLKGNKEVRWGKICHIYDKFCRHVGGAIAVSLFASVVLLLL SIISVLSLYKKIR

Protein Names:Recommended name: CASP-like protein At4g15610

Gene Names:Ordered Locus Names:At4g15610 ORF Names:Dl3845w, FCAALL.139

Expression Region:1-193

Sequence Info:full length protein

30 other products in the same category: