Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:O75915
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGF LSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVM VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLT DYISKVKE
Protein Names:Recommended name: PRA1 family protein 3 Alternative name(s): ADP-ribosylation factor-like protein 6-interacting protein 5 Short name= ARL-6-interacting protein 5 Short name= Aip-5 Cytoskeleton-related vitamin A-responsive protein
Gene Names:Name:ARL6IP5 Synonyms:DERP11, JWA, PRA2, PRAF3 ORF Names:HSPC127
Expression Region:1-188
Sequence Info:Full length protein