View larger

Recombinant Lactobacillus plantarum UPF0397 protein lp_0150(lp_0150)

CSB-CF805000LMS

Recombinant Lactobacillus plantarum UPF0397 protein lp_0150(lp_0150)

See below for Detailed Description

More details

CAD$1,531.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)

Uniprot NO.:Q88ZZ1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQNKQSNSIRTVVATGIGAAVIFVLMKFVAIPTGVPNTQVNVAMGFLALLGAIFGPVAAG LAVFIGHALNDFVTYGSPWWTWVIVDGLIGVAFGLAKNRLKIENGVLGTAKLVWFNIYQI IVNFIGWVLLAPTGDIIIYHEPANKVYLQGVITWIADSISVAIIGTILLVLYARTRTQRG SLTKER

Protein Names:Recommended name: UPF0397 protein lp_0150

Gene Names:Ordered Locus Names:lp_0150

Expression Region:1-186

Sequence Info:full length protein

30 other products in the same category: