View larger

Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_822486 (POPTRDRAFT_822486)

CSB-CF497866EXS

Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_822486 (POPTRDRAFT_822486)

See below for Detailed Description

More details

CAD$1,531.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Uniprot NO.:B9HTK2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRSPQPHRSGGDTQQHFQSTVSVQKLKRFNSLILVFRFAAFCFSLASAVFMLTNSRGSDS LHWYNFDAFRYVFAANAIVAIYSLFEMAASVWEISRNATLFPEICQVWFDFGHDQVFAYL LLSANTAGTELARTLKDTCTDNKAFCVQSDIAIVLGFAGFLFLGISSLFSGFRVVCFIIN GSRFYV

Protein Names:Recommended name: CASP-like protein POPTRDRAFT_822486

Gene Names:ORF Names:POPTRDRAFT_822486

Expression Region:1-186

Sequence Info:full length protein

30 other products in the same category: