View larger

Recombinant Acidithiobacillus ferrooxidans Probable intracellular septation protein A (AFE_0667)

CSB-CF476518AWH

Recombinant Acidithiobacillus ferrooxidans Probable intracellular septation protein A (AFE_0667)

See below for Detailed Description

More details

CAD$1,530.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / NCIB 8455) (Ferrobacillus ferrooxidans (strain ATCC 23270))

Uniprot NO.:B7J5W3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLLTDFLPIILFFVAYRIHGIYTATEVLIVAAILLMAWQWWRRGRVETMTWVSTLLILT FGGLTLYFHNDTFIKIKPSILYVLFAAALLFTHWREEPLLQRLMGGQLPAALPLSFWRRL NGYWIAFFLFGAVLNLIVAYAFSTGIWVDFKLFGMLAITVIFVLFQAVVISRALPQEAKD GDSSA

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:AFE_0667

Expression Region:1-185

Sequence Info:full length protein

30 other products in the same category: