>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: N/A
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Bos taurus (Bovine)
Delivery time: 3-7 business days
Uniprot ID: P84291
AA Sequence: DSELAGPRGARGPHGLSGPHGLSGLSGPSGYTGPIGMSGLTGLRREESEKVWLESKDGQELELVSSGSAQEELELVSSGSAQVSFASYLGASQPLPSELW
Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-100aa
Protein length: Full Length
MW: 17.3 kDa
Alternative Name(s):
Relevance:
Reference: "Characterization of a bovine pregnancy-associated protein using two-dimensional gel electrophoresis, N-terminal sequencing and mass spectrometry." Pyo J., Hwang S.-I., Oh J., Lee S.-J., Kang S.-C., Kim J.-S., Lim J. Proteomics 3:2420-2427(2003)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.