View larger

Recombinant Escherichia coli DNA repair protein recO(recO)

CSB-EP364006ENV

Recombinant Escherichia coli DNA repair protein recO(recO)

See Below for Detailed Description

More details

CAD$1,066.00

More info

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: recO

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Escherichia coli (strain K12)

Delivery time: 3-7 business days

Uniprot ID: P0A7H3

AA Sequence: MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTHYE

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-242aa

Protein length: Full Length

MW: 43.4 kDa

Alternative Name(s): Recombination protein O

Relevance: Involved in DNA repair and RecF pathway recombination.

Reference: Molecular analysis of the Escherichia coli recO gene.Morrison P.T., Lovett S.T., Gilson L.E., Kolodner R.J. Bacteriol. 171:3641-3649(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

30 other products in the same category: