Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yersinia pseudotuberculosis serotype O:3 UPF0266 membrane protein YPK_2467 (YPK_2467)

Recombinant Yersinia pseudotuberculosis serotype O:3 UPF0266 membrane protein YPK_2467 (YPK_2467)

SKU:CSB-CF542485YAX

Regular price $2,094.40 CAD
Regular price Sale price $2,094.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yersinia pseudotuberculosis serotype O:3 (strain YPIII)

Uniprot NO.:B1JP58

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSVTDLVLVVFIALLLIYAIYDEFIMNMMKGKTRLQVHLKRKNKLDCMIFVGLIGILIYN NVMAHGAPLTTYLLVGLALVAVYISYIRWPKLLFKNTGFFYANTFIEYSRIKSMNLSEDG ILVIDLEQRRLLIQVKKLDDLEKIYNFFIENQS

Protein Names:Recommended name: UPF0266 membrane protein YPK_2467

Gene Names:Ordered Locus Names:YPK_2467

Expression Region:1-153

Sequence Info:full length protein

View full details