Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yersinia pseudotuberculosis serotype O:3 UPF0059 membrane protein YPK_2468 (YPK_2468)

Recombinant Yersinia pseudotuberculosis serotype O:3 UPF0059 membrane protein YPK_2468 (YPK_2468)

SKU:CSB-CF543810YAX

Regular price $2,147.60 CAD
Regular price Sale price $2,147.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Yersinia pseudotuberculosis serotype O:3 (strain YPIII)

Uniprot NO.:B1JPQ2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLSATIILAFAMSMDAFAASIGKGATLYKPRFREALRTGLIFGVIEAITPLIGWCIGLF ASQYIMEWDHWIAFSLLFILGCRMIFEGMKQRVAETEKMRSHSFWVLVTTAIATSLDAMA IGVGLAFLQVDIVHTAMAIGLATMIMATLGMLIGRYIGPLLGKRAEIIGGIVLIGIGFNI LYEHMHLTA

Protein Names:Recommended name: UPF0059 membrane protein YPK_2468

Gene Names:Ordered Locus Names:YPK_2468

Expression Region:1-189

Sequence Info:full length protein

View full details