Gene Bio Systems
Recombinant Yersinia pseudotuberculosis serotype IB UPF0299 membrane protein YPTS_1639 (YPTS_1639)
Recombinant Yersinia pseudotuberculosis serotype IB UPF0299 membrane protein YPTS_1639 (YPTS_1639)
SKU:CSB-CF454543YAW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Uniprot NO.:B2JZJ8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRNMMSLCWQYLRAFTIIYLCLWAGKALALLLPIVIPGSIIGMLILFVLLTLQILPSPWV KPSCQLLIRYMALLFVPIGVGVMQYYEQLTKQFGPIVVSCFISTLIVMLVVAYSSHYVHR DRKVISPSTPTEGEK
Protein Names:Recommended name: UPF0299 membrane protein YPTS_1639
Gene Names:Ordered Locus Names:YPTS_1639
Expression Region:1-135
Sequence Info:full length protein
