Gene Bio Systems
Recombinant Yersinia pseudotuberculosis serotype IB UPF0266 membrane protein YPTS_1754 (YPTS_1754)
Recombinant Yersinia pseudotuberculosis serotype IB UPF0266 membrane protein YPTS_1754 (YPTS_1754)
SKU:CSB-CF456459YAW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Uniprot NO.:B2K0F2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSVTDLVLVVFIALLLIYAIYDEFIMNMMKGKTRLQVHLKRKNKLDCMIFVGLIGILIYN NVMAHGAPLTTYLLVGLALVAVYISYIRWPKLLFKNTGFFYANTFIEYSRIKSMNLSEDG ILVIDLEQRRLLIQVKKLDDLEKIYNFFIENQS
Protein Names:Recommended name: UPF0266 membrane protein YPTS_1754
Gene Names:Ordered Locus Names:YPTS_1754
Expression Region:1-153
Sequence Info:full length protein
