Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yersinia pestis bv. Antiqua UPF0756 membrane protein YPA_2248(YPA_2248)

Recombinant Yersinia pestis bv. Antiqua UPF0756 membrane protein YPA_2248(YPA_2248)

SKU:CSB-CF614126YAF

Regular price $2,090.20 CAD
Regular price Sale price $2,090.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yersinia pestis bv. Antiqua (strain Antiqua)

Uniprot NO.:Q1C5Q9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAALDPTLLILLALAALGILSHNMTVTLAILILIAIRITPLNSFFPWVEKYGLTIGVLIL TIGVMAPIASGKISASEVLHSFVQWKSILAIVVGVAVSWLGGRGVSLMTHQPSVVAGLLV GTVLGVALFKGVPVGPLIAAGLLSLVIGKS

Protein Names:Recommended name: UPF0756 membrane protein YPA_2248

Gene Names:Ordered Locus Names:YPA_2248

Expression Region:1-150

Sequence Info:full length protein

View full details