Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yersinia pestis bv. Antiqua UPF0266 membrane protein YPA_1127(YPA_1127)

Recombinant Yersinia pestis bv. Antiqua UPF0266 membrane protein YPA_1127(YPA_1127)

SKU:CSB-CF615421YAF

Regular price $2,094.40 CAD
Regular price Sale price $2,094.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yersinia pestis bv. Antiqua (strain Antiqua)

Uniprot NO.:Q1C8X8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20ā„ƒ, for extended storage, conserve at -20ā„ƒ or -80ā„ƒ.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā„ƒ for up to one week.

AA Sequence:MSVTDLVLVVFIALLLIYAIYDEFIMNMMKGKTRLQVHLKRKNKLDCMIFVGLIGILIYN NVMAHGAPLTTYLLVGLALVAVYISYIRWPKLLFKNTGFFYANTFIEYSRIKSMNLSEDG ILVIDLEQRRLLIQVKKLDDLEKIYNFFIENQS

Protein Names:Recommended name: UPF0266 membrane protein YPA_1127

Gene Names:Ordered Locus Names:YPA_1127

Expression Region:1-153

Sequence Info:full length protein

View full details