Gene Bio Systems
Recombinant Yersinia pestis bv. Antiqua UPF0266 membrane protein YPA_1127(YPA_1127)
Recombinant Yersinia pestis bv. Antiqua UPF0266 membrane protein YPA_1127(YPA_1127)
SKU:CSB-CF615421YAF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia pestis bv. Antiqua (strain Antiqua)
Uniprot NO.:Q1C8X8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20ā, for extended storage, conserve at -20ā or -80ā.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
AA Sequence:MSVTDLVLVVFIALLLIYAIYDEFIMNMMKGKTRLQVHLKRKNKLDCMIFVGLIGILIYN NVMAHGAPLTTYLLVGLALVAVYISYIRWPKLLFKNTGFFYANTFIEYSRIKSMNLSEDG ILVIDLEQRRLLIQVKKLDDLEKIYNFFIENQS
Protein Names:Recommended name: UPF0266 membrane protein YPA_1127
Gene Names:Ordered Locus Names:YPA_1127
Expression Region:1-153
Sequence Info:full length protein
