Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yersinia pestis bv. Antiqua UPF0208 membrane protein YpAngola_A1824 (YpAngola_A1824)

Recombinant Yersinia pestis bv. Antiqua UPF0208 membrane protein YpAngola_A1824 (YpAngola_A1824)

SKU:CSB-CF434981YAM

Regular price $2,091.60 CAD
Regular price Sale price $2,091.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yersinia pestis bv. Antiqua (strain Angola)

Uniprot NO.:A9R6M8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTIKPSDSVSWFQVLQRGQHYMKTWPADKRLAPVFPENRVTVVTRFGIRFMPPLAIFTLT WQIALGGQLGPAIATALFACGLPLQGLWWLGKRAITPLPPTLLQWFHEVRHKLFEAGQAV APIEPIPTYQSLADLLKRAFKQLDKTFLDDL

Protein Names:Recommended name: UPF0208 membrane protein YpAngola_A1824

Gene Names:Ordered Locus Names:YpAngola_A1824

Expression Region:1-151

Sequence Info:full length protein

View full details