Gene Bio Systems
Recombinant Yersinia enterocolitica serotype O:8 - biotype 1B UPF0442 protein YE0625 (YE0625)
Recombinant Yersinia enterocolitica serotype O:8 - biotype 1B UPF0442 protein YE0625 (YE0625)
SKU:CSB-CF374647YAK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081)
Uniprot NO.:A1JJF0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVMSLLWALLQDMVLAAIPALGFAMVFNVPMRALRYCALLGALGHGSRMLMIHFGMDIEP ASLLASIMIGMIGINWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEVL MSTMVTNFLKASFIVGSLSIGLSLPGLWLYRKRPGV
Protein Names:Recommended name: UPF0442 protein YE0625
Gene Names:Ordered Locus Names:YE0625
Expression Region:1-156
Sequence Info:full length protein
