Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yersinia enterocolitica serotype O:8 - biotype 1B Universal stress protein B(uspB)

Recombinant Yersinia enterocolitica serotype O:8 - biotype 1B Universal stress protein B(uspB)

SKU:CSB-CF375673YAK

Regular price $2,032.80 CAD
Regular price Sale price $2,032.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081)

Uniprot NO.:A1JSP6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISTVALFWALCVVCVINMARYYSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQI RLVGYIFAQRYLDHHDPEFIRRCERLRGQFILTSALCGLVMVSLVGLILWY

Protein Names:Recommended name: Universal stress protein B

Gene Names:Name:uspB Ordered Locus Names:YE4049

Expression Region:1-111

Sequence Info:full length protein

View full details