Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081)
Uniprot NO.:A1JRI1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLLPVMVIFGLSFPPIFLELILSLALFFVLRRVLQPTGIYEFVWHPALFNTALYGCLFY LISRLFS
Protein Names:Recommended name: Protein AaeX
Gene Names:Name:aaeX Ordered Locus Names:YE3796
Expression Region:1-67
Sequence Info:full length protein