Gene Bio Systems
Recombinant Yarrowia lipolytica Golgi apparatus membrane protein TVP23(TVP23)
Recombinant Yarrowia lipolytica Golgi apparatus membrane protein TVP23(TVP23)
SKU:CSB-CF731974YAP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Uniprot NO.:Q6C7V5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTLWQRLSESSHPVALVFFLAFRLGALFTYMFGLLFTDKFVLMFVLVVLLLAADFWNVKN IAGRLMVGLRWWNEASETGESVWVFETADPQRYINPIDSKVFWMMLYGAPVLWVCLAVLA LLKFQFLSLILVFIAVSLTVTNAMAYSRCDKFGKANNIVGQVSGGLLSRAARGTFLGRFM
Protein Names:Recommended name: Golgi apparatus membrane protein TVP23
Gene Names:Name:TVP23 Ordered Locus Names:YALI0D25036g
Expression Region:1-180
Sequence Info:full length protein
