Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yarrowia lipolytica Altered inheritance of mitochondria protein 11(AIM11)

Recombinant Yarrowia lipolytica Altered inheritance of mitochondria protein 11(AIM11)

SKU:CSB-CF728239YAP

Regular price $2,102.80 CAD
Regular price Sale price $2,102.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)

Uniprot NO.:Q6C0R5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKFRFGEGAEGTLNTSVTTAMIDQEKRAADLKRRKNQMLLFGGATLATLASCRLTARGIS SRRYIPKMFQANHMPPQSDMVKEAAMAVVFATTMALSSFSMVVFGVAWSQDVTSLKQFAL KMKTKLGAQQIEDEIRNAPMTPETQDLQDQLAGALKKD

Protein Names:Recommended name: Altered inheritance of mitochondria protein 11

Gene Names:Name:AIM11 Ordered Locus Names:YALI0F22367g

Expression Region:1-158

Sequence Info:full length protein

View full details