Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xylella fastidiosa UPF0059 membrane protein Xfasm12_1452 (Xfasm12_1452)

Recombinant Xylella fastidiosa UPF0059 membrane protein Xfasm12_1452 (Xfasm12_1452)

SKU:CSB-CF538828XBM

Regular price $2,156.00 CAD
Regular price Sale price $2,156.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xylella fastidiosa (strain M12)

Uniprot NO.:B0U3E5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSPITILLIGIAMSTDAFAAAIGKGAAIGKPRLRDALYVAVIFGVIETATPIAGWLLGQI ASHYIAAFDHWIAFGLLSGLGIHMIINGLKNNGNTCKDNADTHNRNSRWLTLAATALATS IDAAAIGISLAFLDIHIGIVAAVIGLCTFTMVIFGVMLGRVLGTFVGNRAEIVGGIILII VGSTILYEHLSNTG

Protein Names:Recommended name: UPF0059 membrane protein Xfasm12_1452

Gene Names:Ordered Locus Names:Xfasm12_1452

Expression Region:1-194

Sequence Info:full length protein

View full details