Gene Bio Systems
Recombinant Xylella fastidiosa Large-conductance mechanosensitive channel(mscL)
Recombinant Xylella fastidiosa Large-conductance mechanosensitive channel(mscL)
SKU:CSB-CF801360XAT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Uniprot NO.:Q87FA1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20ā, for extended storage, conserve at -20ā or -80ā.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
AA Sequence:MSFIREFKEFVMRGNVIDLAVAVVIGAAFGKIVTALVDKIISPLIGVMVGGIDFSKLSLT LKAATVDTAGKEVPAVVIGYGDFINTILQFIIIAFAIFIIVKMINKVINKQPLPPETPSE DVLLLREIRDSLKK
Protein Names:Recommended name: Large-conductance mechanosensitive channel
Gene Names:Name:mscL Ordered Locus Names:PD_0027
Expression Region:1-134
Sequence Info:full length protein
