Gene Bio Systems
Recombinant Xenopus tropicalis UPF0767 protein C1orf212 homolog(TGas122k06.1)
Recombinant Xenopus tropicalis UPF0767 protein C1orf212 homolog(TGas122k06.1)
SKU:CSB-CF634710XBF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Uniprot NO.:Q28EM2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MWPVLWAAARTYAPYITFPVAFVVGAVGYQLEWFIRGTPEQPVEELSILEKREERTLQET MGKDVTQVLSLKEKLEFTPKAVLNRNRQEKS
Protein Names:Recommended name: UPF0767 protein C1orf212 homolog
Gene Names:ORF Names:TGas122k06.1
Expression Region:1-91
Sequence Info:full length protein
