Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis UPF0466 protein C22orf32 homolog, mitochondrial(TNeu133h13.1)

Recombinant Xenopus tropicalis UPF0466 protein C22orf32 homolog, mitochondrial(TNeu133h13.1)

SKU:CSB-CF638969XBF

Regular price $1,957.20 CAD
Regular price Sale price $1,957.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q28ED6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AIATSAGTVLPKPEKVSFGLLRVFTVVIPFLYIGTLISKNFAALLEEHDIFVPEDDDDDD

Protein Names:Recommended name: UPF0466 protein C22orf32 homolog, mitochondrial

Gene Names:ORF Names:TNeu133h13.1

Expression Region:40-99

Sequence Info:full length protein

View full details