Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis Serine palmitoyltransferase small subunit A(sptssa)

Recombinant Xenopus tropicalis Serine palmitoyltransferase small subunit A(sptssa)

SKU:CSB-CF738544XBF

Regular price $1,986.60 CAD
Regular price Sale price $1,986.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q6DFT6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKVSCEDINGPRSSLSRAWNHMSWLYYQYLLVTALYMLEPWERTIFNSMLVSIVGMALYT GYIFMPQHILAILHYFEIVQ

Protein Names:Recommended name: Serine palmitoyltransferase small subunit A Alternative name(s): Small subunit of serine palmitoyltransferase A Short name= ssSPTa

Gene Names:Name:sptssa Synonyms:ssspta

Expression Region:1-80

Sequence Info:full length protein

View full details