Gene Bio Systems
Recombinant Xenopus tropicalis Serine palmitoyltransferase small subunit A(sptssa)
Recombinant Xenopus tropicalis Serine palmitoyltransferase small subunit A(sptssa)
SKU:CSB-CF738544XBF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Uniprot NO.:Q6DFT6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKVSCEDINGPRSSLSRAWNHMSWLYYQYLLVTALYMLEPWERTIFNSMLVSIVGMALYT GYIFMPQHILAILHYFEIVQ
Protein Names:Recommended name: Serine palmitoyltransferase small subunit A Alternative name(s): Small subunit of serine palmitoyltransferase A Short name= ssSPTa
Gene Names:Name:sptssa Synonyms:ssspta
Expression Region:1-80
Sequence Info:full length protein
