Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis Selenoprotein S(sels)

Recombinant Xenopus tropicalis Selenoprotein S(sels)

SKU:CSB-CF711365XBF

Regular price $2,147.60 CAD
Regular price Sale price $2,147.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q5I030

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELGNQPGPGNRPEIELEWYQYLQNTVGVVLSSYGWYILLGCILIYLLIQKLPQNFTRAG TSNHSTVTDPDEIVRRQEAVTAARLRMQEELNAQAELYKQKQVQLQEEKRQRNIETWDRM KEGKSSKVACRLGQEPSPSTSTSAATKPKQEKQERKTLRGSGYNPLTGDGGGTCAWRPGR RGPSSGGUG

Protein Names:Recommended name: Selenoprotein S Short name= SelS

Gene Names:Name:sels ORF Names:TNeu072i15.1

Expression Region:1-189

Sequence Info:full length protein

View full details